PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00148924001
Common NameGSBRNA2T00028543001, GSBRNA2T00148924001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MIKC_MADS
Protein Properties Length: 204aa    MW: 23448.2 Da    PI: 9.4093
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00148924001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.72e-25958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien  nr vtfskRrng+ KKA+E+ vLCda+va+i+f+s+gk+ +y+
  GSBRNA2T00148924001  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYC 58
                         79*********************************************997 PP

2K-box60.95e-2171164199
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                          yqk sgk+l++ak+e+l++e++++kke++nLq e+Rhl+Ged++sL+lk+L+ +e+++e++l      K+e+l+++ ++ ++  +e+++ 
  GSBRNA2T00148924001  71 YQKLSGKKLWDAKHENLSNEIDRIKKENDNLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLD-----KMEYLMTKRRNEKMLAEENRQL 155
                          899***********************************************************6.....89*******************9 PP

                K-box  91 nkaLrkkle 99 
                            +L+++ +
  GSBRNA2T00148924001 156 SFQLQQQEM 164
                          999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.333161IPR002100Transcription factor, MADS-box
SMARTSM004325.6E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.33E-34296IPR002100Transcription factor, MADS-box
CDDcd002657.11E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-26323IPR002100Transcription factor, MADS-box
PfamPF003195.0E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-263859IPR002100Transcription factor, MADS-box
PfamPF014866.1E-1282159IPR002487Transcription factor, K-box
PROSITE profilePS5129710.83384165IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIVFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLSNE IDRIKKENDN LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIEH GLDKMEYLMT KRRNEKMLAE ENRQLSFQLQ QQEMAIASNA RGMMMRDHDG  180
QFGYRVQPIQ PNLQEKIMSL VID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J1e-15289180Myocyte-specific enhancer factor 2A
3p57_I1e-15289180Myocyte-specific enhancer factor 2A
3p57_D1e-15289180Myocyte-specific enhancer factor 2A
3p57_C1e-15289180Myocyte-specific enhancer factor 2A
3p57_B1e-15289180Myocyte-specific enhancer factor 2A
3p57_A1e-15289180Myocyte-specific enhancer factor 2A
3kov_J1e-15289180Myocyte-specific enhancer factor 2A
3kov_I1e-15289180Myocyte-specific enhancer factor 2A
3kov_B1e-15289180Myocyte-specific enhancer factor 2A
3kov_A1e-15289180Myocyte-specific enhancer factor 2A
1tqe_S1e-15189181Myocyte-specific enhancer factor 2B
1tqe_R1e-15189181Myocyte-specific enhancer factor 2B
1tqe_Q1e-15189181Myocyte-specific enhancer factor 2B
1tqe_P1e-15189181Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.250981e-133flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00148924001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679620.0KC967962.2 Brassica oleracea var. viridis PI.b (PI.b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009131786.11e-147PREDICTED: floral homeotic protein PISTILLATA
RefseqXP_013626307.11e-147PREDICTED: floral homeotic protein PISTILLATA
RefseqXP_013730998.11e-147PREDICTED: floral homeotic protein PISTILLATA
RefseqXP_013731005.11e-147PREDICTED: floral homeotic protein PISTILLATA
RefseqXP_013740244.11e-147PREDICTED: floral homeotic protein PISTILLATA
SwissprotP480071e-143PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA0A078DHV71e-150A0A078DHV7_BRANA; BnaA03g08030D protein
STRINGBra020093.1-P1e-143(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-144MIKC_MADS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]